PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012570412.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 257aa    MW: 29439.4 Da    PI: 6.1272
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012570412.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.97.1e-3823120198
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkC + C+lapyfp++++++f n+hklFG+ ++++++k++p++ r ++ms+++y+++ ra dPv G++g i++lq+q+e  ++el 
  XP_012570412.1  23 ACAACKYQRRKCGPTCILAPYFPHDRQQQFLNAHKLFGVGKITNMIKNVPPNLRGATMSTIMYQSDLRALDPVGGCYGQIQQLQSQIEFFNSELL 117
                     7***************************************************************************************9999987 PP

          DUF260  96 llk 98 
                      + 
  XP_012570412.1 118 FTL 120
                     665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.07522123IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-3523116IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MNNNNHNNNH NNNSRNGNGT TQACAACKYQ RRKCGPTCIL APYFPHDRQQ QFLNAHKLFG  60
VGKITNMIKN VPPNLRGATM STIMYQSDLR ALDPVGGCYG QIQQLQSQIE FFNSELLFTL  120
QQLALFRGQV HNNNANRHHH HHPQYGIINN NIIPQPAQVL NQSQQHQHYA DEMSMSQPQQ  180
QQLHDDVNNL NLNPNYVPLQ EDLNTWVDSI PLSPLTLQDN RKEEEDEQEQ EQVGDDYAND  240
QKPVLDLITE MNSSDNH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012570412.10.0PREDICTED: LOB domain-containing protein 22-like isoform X1
RefseqXP_012570415.10.0PREDICTED: LOB domain-containing protein 22-like isoform X1
TrEMBLG7IUH83e-89G7IUH8_MEDTR; LOB domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-48LOB domain-containing protein 22